Mod GRF(1-29) comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2026-04-08. Numbers and descriptions here follow the published literature rather than marketing material.
The drug affinity complex is a maleimidopropionic acid group attached to a lysine side chain. It reacts with the free thiol of cysteine-34 on circulating albumin, forming a covalent bond. This conjugation keeps the peptide in the bloodstream and shields it from rapid renal filtration and proteolysis. Reported circulation half-lives for the albumin-bound form fall in the range of roughly six to nine days in early human studies.
Binding to GHRH receptors on pituitary somatotroph cells triggers cyclic AMP signaling and stimulates growth hormone synthesis and release. Because the peptide acts upstream of the pituitary, effects are mediated through endogenous growth hormone rather than direct receptor activation in peripheral tissues. Increases in insulin-like growth factor 1 are generally described as a downstream consequence. Most published human exposure data come from small early-stage studies, and the clinical significance of the pharmacokinetic profile remains incompletely characterized.
CJC-1295 is a synthetic peptide designed to mimic growth hormone-releasing hormone (GHRH), the endogenous signal that prompts the pituitary gland to release growth hormone. The compound is a modified fragment of the natural hormone, spanning the first twenty-nine amino acids of GHRH with several substitutions that slow enzymatic breakdown. Two variants circulate in research settings: one carrying a drug affinity complex (DAC) and one without it. The DAC-free form is frequently labelled Mod GRF(1-29) in catalogs and discussion forums.
The peptide binds GHRH receptors on somatotroph cells within the anterior pituitary, triggering a signalling cascade that increases growth hormone secretion. Its improved resistance to dipeptidyl peptidase IV degradation distinguishes it from the parent hormone. In the DAC-bearing version, a maleimide group reacts with a cysteine residue on serum albumin, forming a covalent bond that keeps the peptide in circulation far longer. That albumin attachment is the central design feature separating the two research variants.
Pharmacokinetic behaviour differs sharply between the two forms. The DAC-bearing peptide shows an extended circulation time measured in days, whereas the version without the complex is cleared within roughly half an hour. This gap shapes how researchers design dosing schedules in animal models. Whether the prolonged presence of the DAC form produces effects meaningfully different from the short-acting variant remains an open question, since comparative human data are scarce.
| Property | Value | Notes |
|---|---|---|
| Physical form | Lyophilized white powder | Supplied as a freeze-dried solid for research use |
| Molecular weight | Approximately 3,647 Da (DAC form) | Lower for the variant lacking the albumin-binding moiety |
| Solubility | Soluble in water and aqueous buffer | Typically dissolved in sterile or bacteriostatic water |
| Typical storage temperature | −20 °C or below | Dry powder, desiccated and protected from light |
| Common analytical method | Reversed-phase HPLC with mass spectrometry | Used for purity estimation and identity confirmation |
The distinguishing feature of the DAC form is a maleimide-containing group that reacts with the free thiol of cysteine-34 on human serum albumin. This reaction forms a covalent bond without enzymatic assistance, and it takes place after the peptide enters the bloodstream. Because albumin is abundant and long-lived, the attached peptide is carried through circulation far longer than an unmodified fragment would survive. The chemistry is a deliberate pharmacokinetic strategy rather than a change to receptor activity.
Enzymatic protection is a separate mechanism from plasma protein binding. The four substitutions in the backbone reduce recognition by dipeptidyl peptidase IV, which normally cleaves the natural hormone within minutes. Without the reactive group, this resistance still yields only a short window of activity, generally reported in the range of tens of minutes. With it, reported half-lives in early human work extended to several days. The size of that gap is the main practical distinction between the two materials.
Both forms act at the pituitary receptor for growth hormone-releasing hormone and increase growth hormone output, which in turn raises insulin-like growth factor 1. A long-acting analog produces sustained rather than pulsatile stimulation, and the physiological consequences of that pattern are not fully settled. Published human data on the extended form remain limited, and much of what circulates in discussion traces to early company reports rather than independent replication. How sustained exposure affects normal feedback remains an open question.
CJC-1295 is the name used for a synthetic peptide modeled on growth hormone-releasing hormone, the hypothalamic signal that prompts the pituitary to release growth hormone. The compound was described by a Canadian drug discovery company in the mid-2000s as a long-acting research tool. Two closely related molecules share the name in practice: one carries a drug affinity complex, or DAC, group, and one does not. The distinction matters because the two behave differently in circulation.
The peptide backbone corresponds to GRF(1-29), the first 29 residues of native growth hormone-releasing hormone, which retains most of the receptor-activating activity of the full-length molecule. Four substitutions distinguish the analog from the natural sequence: D-alanine at position 2, glutamine at position 8, alanine at position 15, and leucine at position 27. These changes slow cleavage by dipeptidyl peptidase IV, the enzyme that degrades native hormone in plasma within minutes. The outcome is improved enzymatic stability combined with a still brief residence time when no additional modification is present.
=== Trace fossils === The Ediacaran fossils of Southern Australia contain trace fossils, which indicate that there were motile benthic organisms. The organisms that produced the traces in the sediments were all worm-like sediment feeders or detritus feeders (Detritivore). There are a few trace fossils, which resemble arthropod trails. Evidence suggests that arthropod-like organisms existed during the Precambrian. This evidence is in the type of trails left behind; specifically one specimen that shows six pairs of symmetrically placed impressions, which resemble trilobite walking trails.
Whitesides, "Self-assembly is the autonomous organization of components into patterns or structures without human intervention." Another definition by Serge Palacin & Renaud Demadrill is "Self-assembly is a spontaneous and reversible process that brings together in a defined geometry randomly moving distinct bodies through selective bonding forces." Importance To commemorate the 125th anniversary of Science magazine, 25 urgent questions were asked for scientists to solve, and the only one that relates to chemistry is"How Far Can We Push Chemical Self-Assembly?" Because self-assembly is the only approach for building a wide variety of nanostructures, the need for increasing complexity is growing. To learn from nature and build the nanoworld with noncovalent bonds, more research is needed in this area. Self assembly of nanomaterials is currently considered broadly for nano-structuring and nano-fabrication because of its simplicity, versatility and spontaneity. Exploiting the properties of the nano assembly holds promise as a low-cost and high-yield technique for a wide range of scientific and technological applications and is a key research effort in nanotechnology, molecular robotics, and molecular computation. A summary of benefits of self-assembly in fabrication is listed below:
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
Sources: en.wikipedia.org
Animal studies indicate the amatoxins deplete hepatic glutathione; N-acetylcysteine serves as a glutathione precursor and may therefore prevent reduced glutathione levels and subsequent liver damage. None of the antidotes used have undergone prospective, randomized clinical trials, and only anecdotal support is available. Silibinin and N-acetylcysteine appear to be the therapies with the most potential benefit. Repeated doses of activated carbon may be helpful by absorbing any toxins that are returned to the gastrointestinal tract following enterohepatic circulation. Other methods of enhancing the elimination of the toxins have been trialed; techniques such as hemodialysis, hemoperfusion, plasmapheresis, and peritoneal dialysis have occasionally yielded success but overall do not appear to improve outcome. In patients developing liver failure, a liver transplant is often the only option to prevent death. Liver transplants have become a well-established option in amatoxin poisoning. This is a complicated issue, however, as transplants themselves may have significant complications and mortality; patients require long-term immunosuppression to maintain the transplant. That being the case, there has been a reassessment of criteria such as onset of symptoms, prothrombin time (PTT), serum bilirubin, and presence of encephalopathy for determining at what point a transplant becomes necessary for survival.
== History and discovery == Although isomerization of proteins has been known about since 1968 when it was discovered by C. Tanford, proline isomerization and its use as a noncovalent histone tail modification was not discovered until 2006 by Nelson and his colleagues.
Sanders also chaired the Senate Veterans' Affairs Committee from 2013 to 2015, the Senate Budget Committee from 2021 to 2023, and the Senate Health, Education, Labor and Pensions Committee from 2023 to 2025. He is the senior senator and dean of the Vermont congressional delegation. Sanders was a candidate for the Democratic presidential nomination in 2016 and 2020, finishing second both times. His 2016 campaign generated enthusiasm and funding from small-dollar donors, helping him win 23 primaries and caucuses. In 2020, his strong showing in early primaries and caucuses made him the front-runner in a large field of Democratic candidates. He became a close ally of Joe Biden after the 2020 primaries. Since Donald Trump's non-consecutive reelection as president of the United States in 2024, Sanders has vocally opposed Trump's second administration and what he describes as a right-wing oligarchy, organizing rallies against Trump and his allies, especially Elon Musk, as part of an effort to reshape the Democratic Party. Sanders is credited with influencing a leftward shift in the Democratic Party after his 2016 campaign. An advocate of progressive policies, he opposes neoliberalism and authoritarianism. He supports workers' self-management, universal and single-payer healthcare, paid parental leave, tuition-free tertiary education, a Green New Deal, and worker control of production through cooperatives, unions, and democratic public enterprises.
Sources: en.wikipedia.org
== Personal life == Samberg is married to musician Joanna Newsom. He described himself as her "superfan", and they met at one of her concerts in 2006. After five years of dating, Samberg proposed to her in February 2013, and they married on September 21, 2013, in Big Sur, California, with Saturday Night Live co-star Seth Meyers serving as Samberg's groomsman. In March 2014, Samberg and Newsom purchased the Moorcrest estate in the Beachwood Canyon area of Los Angeles, California, which was associated with various historical figures: in the 1920s, it was owned by the parents of actress Mary Astor; prior to that, Charlie Chaplin rented it. The couple also owns a home in Manhattan's West Village. They announced the birth of their daughter on August 8, 2017. The birth of their second child, a son, was announced by the Lonely Island's Jorma Taccone in February 2023. Samberg, who grew up in the East Bay, is a fan of the Oakland Athletics and the Golden State Warriors. Samberg was raised in a Jewish family, but considers himself "not particularly religious".
=== By children in Gaza === In November 2023, a group of children outside al-Shifa Hospital held a press conference asking the world for an end to the war. A small group of children in Rafah held their own protest in advance of a planned Rafah offensive in February 2024, holding signs in English that read "We refuse to die" and "Save us from this genocide". Children in Rafah again held their own protest against the Gaza Strip famine on 6 March, holding a banner reading "Stop our daily death". In February 2024, a boy wounded in an Israeli attack stated, "I don’t know why they attacked me. They are picking fights against the children of Palestine. Why?" In July 2024, a 10th grade student in Ramallah said hearing explosions on the news "just twisted something inside of me, like I felt those emotions coming out. I was scared. I was terrified, actually. It could be me next."
Blood pH is regulated to stay within the narrow range of 7.35 to 7.45, making it slightly basic (compensation). Extra-cellular fluid in blood that has a pH below 7.35 is too acidic, whereas blood pH above 7.45 is too basic. A pH below 6.9 or above 7.8 is usually lethal. Blood pH, partial pressure of oxygen (pO2), partial pressure of carbon dioxide (pCO2), and bicarbonate (HCO3−) are carefully regulated by a number of homeostatic mechanisms, which exert their influence principally through the respiratory system and the urinary system to control the acid–base balance and respiration, which is called compensation. An arterial blood gas test measures these. Plasma also circulates hormones transmitting their messages to various tissues. The list of normal reference ranges for various blood electrolytes is extensive.
Sources: en.wikipedia.org
The two share the same 29-amino-acid backbone. CJC-1295 carries an additional albumin-binding moiety that markedly extends its residence time in circulation, while the form without that moiety clears faster. Literature sometimes applies the name loosely to either variant.
It has not been approved by major regulatory agencies for any therapeutic indication. Material sold under this name is typically distributed for laboratory research only. Clinical use is not supported by large controlled trials.
Early human studies of the albumin-binding form reported circulation half-lives on the order of several days. The value depends on assay method and study design. Estimates for the form without the binding moiety are considerably shorter.
The synthetic peptide keeps the receptor-binding region of GHRH but carries substitutions that resist enzymatic cleavage. In the DAC version, an added group also anchors the molecule to albumin, extending its presence in the bloodstream.