A practical reference on Phosphocreatine: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-08-25. Anything still debated is marked as such rather than presented as settled.
Creatine is synthesized endogenously in humans, mainly in the liver, kidney, and pancreas, from the amino acids arginine, glycine, and methionine. Skeletal muscle stores much of the body's creatine, where it participates in the phosphocreatine system that buffers adenosine triphosphate during short, intense contractions. Dietary sources include meat and fish, so omnivorous diets provide additional creatine beyond endogenous production. Supplemental creatine monohydrate supplies the same molecule found in food and tissues, not a distinct drug or hormone. Research interest centers on its role in cellular energy transfer and its effects on muscle and other tissues.
Several creatine forms are sold, including monohydrate, anhydrous, hydrochloride, nitrate, citrate, and blends. Once dissolved, these forms deliver creatine, but they differ in molar mass, solubility, counterions, and water content. Creatine monohydrate has the largest body of published human data among these forms. Questions remain about whether any alternative form offers meaningful advantages in absorption, tolerability, or tissue uptake under practical conditions. The hydrate form's lower creatine content by mass is a compositional fact, not a statement about effectiveness.
Creatine monohydrate is a crystalline compound formed when one molecule of creatine associates with one molecule of water in the solid lattice. Its molecular formula is C4H11N3O3, and its molar mass is about 149.15 grams per mole. The material appears as a white, odorless powder that dissolves sparingly in water at room temperature. The monohydrate designation distinguishes it from anhydrous creatine, which lacks the bound water and has a lower molar mass. This hydrate is the most common commercial form of creatine used in nutritional and research settings.
As a supplement, creatine monohydrate is studied for its effects on muscle performance and recovery. The compound is often described as an ergogenic aid, meaning it may support physical work capacity. Research typically compares it with placebo or other forms, such as citrate or nitrate, under controlled conditions. Questions remain about the optimal dose and long-term effects in different populations, and findings are not uniform across all studies. The monohydrate form remains the most extensively tested.
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Its systematic name is N-(aminoiminomethyl)-N-methylglycine monohydrate, and it appears as a white, odorless powder with limited solubility in water. The monohydrate is the most common solid form used in research and commercial products because it is stable under dry conditions. The anhydrous form lacks the water of crystallization and differs slightly in molar mass. Both forms participate in the same biochemical reactions once dissolved.
In the body, creatine is synthesized from the amino acids arginine, glycine, and methionine, primarily in the liver and kidneys. It is transported to muscle and other tissues, where it is phosphorylated to phosphocreatine by creatine kinase. This phosphagen system provides a rapid source of adenosine triphosphate during short, intense contractions. Dietary creatine comes mainly from meat and fish, and the body's total pool is influenced by both synthesis and intake.
| Property | Value | Notes |
|---|---|---|
| Chemical formula | C4H11N3O3 | Often written C4H9N3O2·H2O |
| Molar mass | 149.15 g/mol | Anhydrous creatine is 131.13 g/mol |
| Appearance | White crystalline powder | Odorless, fine or granular |
| Water solubility | About 13 g/L at 25 °C | Low; increases with temperature |
| Common synonyms | Creatine hydrate; N-carbamimidoylsarcosine monohydrate | CAS 6020-87-7 |
Stability studies examine how creatine monohydrate changes under controlled temperature and humidity. The solid is generally stable when kept dry, but moisture can promote hydrolysis to creatinine, especially in solution or at elevated temperatures. Color, odor, and assay values are monitored over time to detect degradation. Because degradation pathways depend on storage conditions, shelf-life claims should specify the tested packaging, temperature, and humidity. Open questions remain about the long-term behavior of different crystal habits and particle sizes.
Regulatory treatment of creatine monohydrate varies by country and intended use. In some jurisdictions it is sold as a dietary supplement, while in others it may be treated as a food ingredient or a pharmaceutical raw material. Pharmacopeial monographs, where available, define identification, assay limits, and impurity thresholds. Manufacturers often follow these monographs or internal specifications to ensure batch-to-batch consistency. Analytical method validation is important because different methods can yield different apparent purity values if sample preparation or detection conditions are not controlled.
Creatine monohydrate is the hydrated form of creatine, a nitrogen-containing organic acid involved in cellular energy transfer. Its molecular formula is C4H11N3O3, and it consists of creatine plus one water molecule in the crystal lattice. The anhydrous base, creatine, has the formula C4H9N3O2. The compound appears as a white, odorless, crystalline powder and is classified as a guanidine derivative. It is distinct from creatinine, a breakdown product measured in clinical chemistry.
In animals, creatine is synthesized mainly in liver, kidney, and pancreas from arginine, glycine, and methionine. The first committed step transfers a guanidino group from arginine to glycine, forming guanidinoacetate. Subsequent methylation by S-adenosylmethionine yields creatine. Dietary sources include meat and fish; endogenous synthesis supplies part of the body pool. Most creatine is stored in skeletal muscle, where it is converted to phosphocreatine and participates in rapid regeneration of adenosine triphosphate during short, intense activity.
In the human body, creatine is synthesized mainly in the liver and kidneys from the amino acids glycine, arginine, and methionine. Dietary sources include meat, fish, and other animal tissues, which supply preformed creatine. Because plant foods contain little or no creatine, dietary intake varies widely among populations. The compound is stored largely in skeletal muscle, where it is converted to phosphocreatine and used to regenerate adenosine triphosphate during short bursts of activity.
Creatine monohydrate is one of several solid forms of creatine described in the literature. Other forms include anhydrous creatine, creatine hydrochloride, and creatine ethyl ester, each with different solubility and stability characteristics. The monohydrate is distinct from creatinine, a spontaneous breakdown compound that forms when creatine loses water and cyclizes. Commercial descriptions sometimes use synonyms such as methylguanidoacetic acid or N-(aminoiminomethyl)-N-methylglycine, which refer to the same base molecule. These names appear in chemical databases and product labels.
Creatine monohydrate is a crystalline compound formed when one molecule of creatine binds with one molecule of water. Creatine itself is a nitrogen-containing organic acid involved in cellular energy transfer, particularly in muscle and nerve tissue. The monohydrate form is the most common solid form used in research and commercial products because it is relatively stable and easy to handle. Its molecular formula is C4H9N3O2·H2O, and its molar mass is about 149.15 grams per mole.
The advantage in atom economy of using NCAs for peptide formation is that there is no need for a protecting group on the functional group reacted with the amino acid. For example, the Merrifield synthesis depends on the use of Boc and Bzl protecting groups, which need be removed after the reaction. In the case of Bailey peptide synthesis, the free peptide is directly obtained after the reaction. However, unwanted and difficult to remove by-products may be formed. An N-substitution of the NCA (for example, by an o-nitrophenylsulfenyl group) can simplify the subsequent purification process, but on the other hand deteriorates the atom economy of the reaction. The synthesis of NCAs can be carried out by the Leuchs reaction or by the reaction of N-(benzyloxycarbonyl)-amino acids with oxalyl chloride. In the latter case, again the procedure is less efficient in the sense of atom economy. The following peptides were synthesized using this method by 1949:
In the first decade of the 21st century, what was called "age management medicine" was considered a field of alternative medicine, and, as of 2007, was not recognized by the American Medical Association. Other names at this time included "antiaging medicine" and "regenerative medicine". Age management medicine is controversial. The field is underregulated and supported by insufficient scientific evidence. People who practice it open themselves up to legal liability on grounds of negligence–malpractice, warranty issues, and product liability. The use of growth hormone has been frequently recommended; however, such use is associated with cancer. Age management medicine is often promoted by anti-aging practitioners specializing in nutritional supplements and hormone-replacement, a practice that may lead to harmful side-effects.
The role of inflammation in cancer is not well understood. Some organs of the body show greater risk of cancer when they are chronically inflamed. While there is an association between increased levels of C-reactive protein and risk of developing cancer, there is no association between genetic polymorphisms influencing circulating levels of CRP and cancer risk. In a 2004 prospective cohort study on colon cancer risk associated with CRP levels, people with colon cancer had higher average CRP concentrations than people without colon cancer. It can be noted that the average CRP levels in both groups were well within the range of CRP levels usually found in healthy people. However, these findings may suggest that low inflammation level can be associated with a lower risk of colon cancer, concurring with previous studies that indicate anti-inflammatory drugs could lower colon cancer risk.
The Society recognizes achievements and promotes academic research through four annual awards. The Biemann Medal and the John B. Fenn Award for a Distinguished Contribution in Mass Spectrometry both are awarded in recognition of singular achievements or contributions in fundamental or applied mass spectrometry, with the Biemann Medal being focused on individuals who are early in their careers. The Ronald A. Hites Award is awarded for outstanding original research demonstrated in papers published in the Journal of the American Society for Mass Spectrometry. The Research Awards are given to young scientists in mass spectrometry, based on the evaluation of their proposed research. The Fellows of ASMS are awarded to individuals in recognition for their scientific contribution to mass spectrometry and for their contribution to the ASMS community. Journal of the American Society for Mass Spectrometry Measuring Mass: From Positive Rays to Proteins The past presidents of ASMS are:
Artificial white blood cells are typically membrane bound vesicles designed to mimic the immunomodulatory behavior of naturally produced leukocytes. While extensive research has been done with regards to artificial red blood cells and platelets for use in emergency blood transfusions, research into artificial white blood cells has been focused on increasing the immunogenic response within a host to treat cancer or deliver drugs in a more favorable fashion. While certain limitations have prevented leukocyte mimicking particles from becoming widely used and approved by regulatory bodies (e.g., US FDA, EU EMA, UK MHRA, JP PMDA, AU TGA), more research is being allocated to this area of synthetic blood which has the potential for producing a new form of treatment for cancer and other diseases.
Sources: en.wikipedia.org
Immunomodulating agents regulate the immune system's response and are produced by various immune cells. These agents include the following agents and markers: The BCG vaccine has been used against tuberculosis, mycobacteria, and various cancers in the form of vaccination as an initial immune system stimulant. In cancer, the anti-tumor immunological effects are elicited by the host's immune response and the BCG infection against the tumor cells, most commonly in bladder cancer. The immune activation allows for further recognition and elimination of malignant tumor cells. Specific active immunotherapy administers a specific antigen as the therapy. The therapy allows the host to create an antigen-specific response with the development of antibodies, proliferation of cytotoxic T lymphocyte responses, or both, directed at the desired pathogen or malignant tumor cell in the case of cancer therapy.
Initial letters are used where there is no ambiguity: C cysteine, H histidine, I isoleucine, M methionine, S serine, V valine. No other amino acids in this set begin with each of those letters. Where arbitrary assignment is needed, the structurally simpler amino acids are given precedence: A alanine, G glycine, L leucine, P proline, T threonine. For example, alanine is simpler than arginine or asparagine, the other amino acids starting with "a". F PHenylalanine and R aRginine are assigned by being phonetically suggestive, W tryptophan is assigned based on the double ring being visually suggestive to the bulky letter W, K lysine and Y tyrosine are assigned as alphabetically nearest to their initials L and T (note that U was avoided for its similarity with V, while X was reserved for undetermined or atypical amino acids); for tyrosine the mnemonic tYrosine was also proposed, D aspartate was assigned arbitrarily, with the proposed mnemonic asparDic acid; E glutamate was assigned in alphabetical sequence being larger by merely one methylene –CH2– group, N asparagine was assigned arbitrarily, with the proposed mnemonic asparagiNe; Q glutamine was assigned in alphabetical sequence of those still available (note again that O was avoided due to similarity with D), with the proposed mnemonic Qlutamine.
The fas receptor (First apoptosis signal) – (also known as Apo-1 or CD95) is a transmembrane protein of the TNF family which binds the Fas ligand (FasL). The interaction between Fas and FasL results in the formation of the death-inducing signaling complex (DISC), which contains the FADD, caspase-8 and caspase-10. In some types of cells (type I), processed caspase-8 directly activates other members of the caspase family, and triggers the execution of apoptosis of the cell. In other types of cells (type II), the Fas-DISC starts a feedback loop that spirals into increasing release of proapoptotic factors from mitochondria and the amplified activation of caspase-8.
Subfamily ABCC contains thirteen members and nine of these transporters are referred to as the Multidrug Resistance Proteins (MRPs). The MRP proteins are found throughout nature and they mediate many important functions. They are known to be involved in ion transport, toxin secretion, and signal transduction. Of the nine MRP proteins, four of them, MRP4, 5, 8, 9, (ABCC4, 5, 11, and 12), have a typical ABC structure with four domains, comprising two membrane spanning domains, with each spanning domain followed by a nucleotide binding domain. These are referred to as short MRPs. The remaining 5 MRP's (MRP1, 2, 6, 7) (ABCC1, 2, 3, 6 and 10) are known as long MRPs and feature an additional fifth domain at their N terminus. CFTR, the transporter involved in the disease cystic fibrosis, is also considered part of this subfamily. Cystic fibrosis occurs upon mutation and loss of function of CFTR. The sulfonylurea receptors (SUR), involved in insulin secretion, neuronal function, and muscle function, are also part of this family of proteins. Mutations in SUR proteins are a potential cause of Neonatal diabetes mellitus. SUR is also the binding site for drugs such as sulfonylureas and potassium-channel openers activators such as diazoxide.
Sources: en.wikipedia.org
Arrestins block GPCR coupling to G proteins in two ways. First, arrestin binding to the cytoplasmic face of the receptor occludes the binding site for heterotrimeric G-protein, preventing its activation (desensitization). Second, arrestin links the receptor to elements of the internalization machinery, clathrin and clathrin adaptor AP2, which promotes receptor internalization via coated pits and subsequent transport to internal compartments, called endosomes. Subsequently, the receptor could be either directed to degradation compartments (lysosomes) or recycled back to the plasma membrane where it can again signal. The strength of arrestin-receptor interaction plays a role in this choice: tighter complexes tend to increase the probability of receptor degradation (Class B), whereas more transient complexes favor recycling (Class A), although this rule is far from absolute. More recently direct interactions between Gi/o family G proteins and Arrestin were discovered downstream of multiple receptors, regardless of canonical G protein coupling. These recent findings introduce a GPCR signaling mechanism distinct from canonical G protein activation and β-arrestin desensitization in which GPCRs cause the formation of Gαi:β-arrestin signaling complexes.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Water chemistry analyses are carried out to identify and quantify the chemical components and properties of water samples. The type and sensitivity of the analysis depends on the purpose of the analysis and the anticipated use of the water. Chemical water analysis is carried out on water used in industrial processes, on waste-water stream, on rivers and stream, on rainfall and on the sea. In all cases the results of the analysis provides information that can be used to make decisions or to provide re-assurance that conditions are as expected. The analytical parameters selected are chosen to be appropriate for the decision-making process or to establish acceptable normality. Water chemistry analysis is often the groundwork of studies of water quality, pollution, hydrology and geothermal waters. Analytical methods routinely used can detect and measure all the natural elements and their inorganic compounds and a very wide range of organic chemical species using methods such as gas chromatography and mass spectrometry. In water treatment plants producing drinking water and in some industrial processes using products with distinctive taste and odors, specialized organoleptic methods may be used to detect smells at very low concentrations.
Sources: en.wikipedia.org
It is the hydrated crystalline form of creatine, containing one bound water molecule per creatine unit. The compound is commonly used as a nutritional ingredient and as a research material.
Yes, endogenous synthesis occurs mainly in the liver, kidney, and pancreas. Meat and fish also contribute creatine to the diet.
Other forms contain creatine paired with different counterions or lacking water, so their mass and solubility differ. After dissolution, creatine itself is the shared active molecule.
It is a compound made of creatine bound to one water molecule. It appears as a white crystalline powder and is the most common solid form of creatine used in research and supplements.